DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13613 and CG13616

DIOPT Version :9

Sequence 1:NP_001097900.2 Gene:CG13613 / 42910 FlyBaseID:FBgn0039193 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_651262.1 Gene:CG13616 / 42917 FlyBaseID:FBgn0039200 Length:231 Species:Drosophila melanogaster


Alignment Length:243 Identity:51/243 - (20%)
Similarity:84/243 - (34%) Gaps:77/243 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GQVSLLLITLIRPIYGLLLFPTSTVLQLTSS-----------------ISIPADLNTRTKVFMDM 60
            |..|||.:.|      ||....|.|:.::|:                 ::.|...:....|.|.:
  Fly     7 GHFSLLALCL------LLHEVQSQVMSMSSAANRTGEVTKVLRRHKRYLAFPEGSSVSGAVCMTI 65

  Fly    61 GFQMN---------------YNLPPTVSAF-----YNATIWADELSRRQKRQLDHSLDANLQQYD 105
            |...|               |:||......     .|||:..|.:.||.:|              
  Fly    66 GMIGNPDVDYLSWAVNWGVAYDLPNHQWVIQHAHGLNATLAKDTIKRRSRR-------------- 116

  Fly   106 LEGGMHPADFTAGQLYKGIENMLETYGFH-RSCLLRSVCELALHPFAEDHFYGMVTQVI--TFLL 167
                         ..|..::::.:..||: |||:.|::||.|...........|:.:::  .|.|
  Fly   117 -------------AFYDEVQSLFDNMGFNGRSCVARALCESAKFMLPSVERGNMLQELVRTVFSL 168

  Fly   168 TPSQHEGFADDEQHYRDK-YEKAEQIGFLGGQCHLSYPSCQADIINLA 214
            .||..........|..|: |.::::   ....||..||.||..::.||
  Fly   169 PPSPVAAHEPQAHHQYDRIYRRSKR---SSRDCHEIYPGCQFSLLALA 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13613NP_001097900.2 DM4_12 119..206 CDD:285126 22/90 (24%)
CG13616NP_651262.1 DM4_12 110..212 CDD:214785 27/131 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452613
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.