DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13613 and CG17780

DIOPT Version :9

Sequence 1:NP_001097900.2 Gene:CG13613 / 42910 FlyBaseID:FBgn0039193 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster


Alignment Length:87 Identity:22/87 - (25%)
Similarity:43/87 - (49%) Gaps:13/87 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 YKGIENMLETYGFH-RSCLLRSVCELALHPFAEDHFYGMVTQVITFLLTPSQHEGFADDEQHYRD 184
            |:.:..:::..|.. |:|:|::.|.    ..|.||..|.:.:::.::.|..:|     |::|...
  Fly   262 YELLHELIDRSGLDGRACVLKAYCT----ALAGDHGQGFLFKLLKYVFTLDEH-----DKRHMPH 317

  Fly   185 -KYEKAEQIGFLGGQCHLSYPS 205
             :.|..|||  :...|.||:.|
  Fly   318 LREENCEQI--MHSHCPLSFDS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13613NP_001097900.2 DM4_12 119..206 CDD:285126 22/87 (25%)
CG17780NP_732995.1 DM4_12 136..>188 CDD:285126
DM4_12 253..338 CDD:214785 22/87 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.