DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13613 and CG17784

DIOPT Version :9

Sequence 1:NP_001097900.2 Gene:CG13613 / 42910 FlyBaseID:FBgn0039193 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_651254.1 Gene:CG17784 / 42909 FlyBaseID:FBgn0039192 Length:237 Species:Drosophila melanogaster


Alignment Length:196 Identity:44/196 - (22%)
Similarity:80/196 - (40%) Gaps:46/196 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VLQLTSSISIPADLNTRTKVFMDMGFQMNYNL-----PPTVS----AFYNATIW---ADELSRRQ 89
            |::|..|::.|.....:     :..|...:||     |.|:.    :|:|.|.:   |.|..:..
  Fly    71 VVKLVPSLAYPVKQTDK-----EQSFWWFFNLQGQWIPTTIPLYWWSFWNTTAFVSTAREWRKDM 130

  Fly    90 KRQLDHSLDANLQQYD-LEGGMHPADFTAGQLYKGIENMLETYGFHRSCLLRSVCELALHPFAED 153
            :.::.|. :|....|: :|.||...|    ..|.|:            |||||:||::..||...
  Fly   131 QAKVLHD-EARTWVYNAIEVGMEQLD----GAYGGV------------CLLRSICEISQKPFQNS 178

  Fly   154 HFYGMVTQVITFLLTPSQHEGFADDEQHYRDKYEKAEQIGFLGGQCHLSYPSCQADIINLATRLV 218
            :.:   ::::..:|.|:.        .:...||..|...|..|..|..:|..|...:.:|.|.:.
  Fly   179 NIF---SEIVNAVLVPTL--------DNVASKYLHARDAGRGGADCERTYSDCNPLLWSLVTNMA 232

  Fly   219 R 219
            :
  Fly   233 K 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13613NP_001097900.2 DM4_12 119..206 CDD:285126 20/86 (23%)
CG17784NP_651254.1 DM4_12 135..227 CDD:214785 28/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.