DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13613 and CG33342

DIOPT Version :9

Sequence 1:NP_001097900.2 Gene:CG13613 / 42910 FlyBaseID:FBgn0039193 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097904.1 Gene:CG33342 / 2768684 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster


Alignment Length:194 Identity:41/194 - (21%)
Similarity:74/194 - (38%) Gaps:26/194 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LLLFPTSTVLQLTSSISIP-ADLNTRTKVFMDMGFQMNYNLPPTVSAFYNATIWADELSRRQKRQ 92
            |.:|......::.:.::.| ...:|...|:..:.:|..|  .|:....|..:.|.........|:
  Fly    46 LAIFNGQGTNKIVAGLAFPIKQADTVQSVWGFVNYQAQY--VPSPVPIYWWSFWNTSTFLSTARE 108

  Fly    93 LDHSLDANLQQYDLEGGMHPADFTAGQLYKGIENMLETYGFHR--SCLLRSVCELALHPFAEDHF 155
            ....:.:.:.|          |.|...||..:|..||..|...  :|||:.:||::..||..:..
  Fly   109 WRKGIRSRVFQ----------DETRVWLYDVVETGLERLGDRNAGACLLKCICEISQRPFMHNSI 163

  Fly   156 YGMVTQVITFLLTPSQHEGFADDEQHYRDKYEKAEQIGFLGGQCHLSYPSCQADIINLATRLVR 219
            :|   :::..:|.||.        .:..:||..|...|..|..|..:|..|.....|...::.|
  Fly   164 FG---EILNAVLVPSL--------DNVPEKYLHARNAGKAGANCRKTYSDCSKAFWNKLIQMAR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13613NP_001097900.2 DM4_12 119..206 CDD:285126 24/88 (27%)
CG33342NP_001097904.1 DM4_12 123..203 CDD:285126 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.