DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Golgin84 and golg-5

DIOPT Version :10

Sequence 1:NP_651250.2 Gene:Golgin84 / 42905 FlyBaseID:FBgn0039188 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_492137.1 Gene:golg-5 / 172527 WormBaseID:WBGene00011975 Length:551 Species:Caenorhabditis elegans


Alignment Length:30 Identity:9/30 - (30%)
Similarity:18/30 - (60%) Gaps:4/30 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 LKGVEAVAIHGGKDQEERYRSVESFRNQEK 476
            ::||:||.|    |..::..:|..:.:|:|
 Worm    26 MRGVDAVEI----DMVQQKVTVTGYADQKK 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Golgin84NP_651250.2 hsdR 136..>230 CDD:236912
Golgin_A5 210..515 CDD:462900 9/30 (30%)
golg-5NP_492137.1 SMC_prok_B <115..363 CDD:274008
Golgin_A5 262..551 CDD:462900
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.