DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6454 and AT3G55470

DIOPT Version :10

Sequence 1:NP_651249.2 Gene:CG6454 / 42904 FlyBaseID:FBgn0039187 Length:1569 Species:Drosophila melanogaster
Sequence 2:NP_191107.1 Gene:AT3G55470 / 824713 AraportID:AT3G55470 Length:156 Species:Arabidopsis thaliana


Alignment Length:120 Identity:35/120 - (29%)
Similarity:59/120 - (49%) Gaps:11/120 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DAFVEIKLASVTHKTDVFRK--SLNPTWNTDWFRFEVD-DAELQDEPLQIRLMDYDTYSANDAIG 87
            |.:|||:....|.|:.|.::  ..||||| |..::..: .....|..|.:::||:||:|::|.||
plant    26 DPYVEIQYKGQTRKSSVAKEDGGRNPTWN-DKLKWRAEFPGSGADYKLIVKVMDHDTFSSDDFIG 89

  Fly    88 KVNISLNPLCLESSSQAVHGKGT--VLSGWIPVFDTMHGIRGEINVIVKVDLFSD 140
            :..:.:..| ||...:    |||  :......:.|:.....||:.:.|...|..|
plant    90 EATVHVKEL-LEMGVE----KGTAELRPTKYNIVDSDLSFVGELLIGVSYSLLQD 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6454NP_651249.2 C2_KIAA0528-like 5..121 CDD:176070 29/99 (29%)
AT3G55470NP_191107.1 C2_putative_Elicitor-responsive_gene 4..128 CDD:176014 31/107 (29%)

Return to query results.
Submit another query.