DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dis3 and EMB2730

DIOPT Version :10

Sequence 1:NP_651246.2 Gene:Dis3 / 42900 FlyBaseID:FBgn0039183 Length:982 Species:Drosophila melanogaster
Sequence 2:NP_195845.2 Gene:EMB2730 / 830864 AraportID:AT5G02250 Length:803 Species:Arabidopsis thaliana


Alignment Length:55 Identity:13/55 - (23%)
Similarity:23/55 - (41%) Gaps:17/55 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 YYLHVYIPSETNAGNYFFGMLAGITY-----------YHLKDNPN-----AKSIL 317
            ::||::..:.| .||.:.....|.::           .|:.|||:     .||.|
plant   502 HHLHLHAITHT-GGNPYTCTECGKSFRAKSTLLKHQKLHVGDNPHKCAECGKSFL 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dis3NP_651246.2 PIN_Rrp44-like 9..203 CDD:350211
VacB 247..946 CDD:440323 13/55 (24%)
EMB2730NP_195845.2 RNB 399..693 CDD:459934 13/55 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.