DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASCL1 and Fer3

DIOPT Version :9

Sequence 1:NP_004307.2 Gene:ASCL1 / 429 HGNCID:738 Length:236 Species:Homo sapiens
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:221 Identity:56/221 - (25%)
Similarity:88/221 - (39%) Gaps:70/221 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    13 GQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQQQAPQLRPAADGQPSGG 77
            ||:..|.|..|:....|.|..|..:.               .|:.|.....|| ||:.:|:.:| 
  Fly    23 GQEAPPPPIVPYQELIAGFPCTDLSL---------------WQRSQVTPLVPQ-RPSTNGRANG- 70

Human    78 GHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARR---NERERNRVKLVNLGFA 139
                          ||....:.:||:              |::|:|   |.|||.|:..:|..|.
  Fly    71 --------------SSSSSKKTRRRV--------------ASMAQRRAANIRERRRMFNLNEAFD 107

Human   140 TLREHVPNGAANKKMSKVETLRSAVEYIRALQQLL------------DEHDAVSAAFQAGVLSPT 192
            .||..||..|..|::|::||||.|:.||..:.:||            |.:.:::...||.  .|.
  Fly   108 KLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELLSGTPSNSHKSRSDVYGSMNGHHQAP--PPA 170

Human   193 ISPNYSNDLNSMAGSPVSSYSSDEGS 218
            |.|::.:        |.::|..|..|
  Fly   171 IHPHHLH--------PAAAYQRDFAS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASCL1NP_004307.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 5/12 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..98 10/55 (18%)
bHLH_TS_ASCL1_Mash1 115..185 CDD:381585 27/84 (32%)
Fer3NP_524322.1 HLH 87..135 CDD:278439 20/47 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.