DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASCL1 and ato

DIOPT Version :10

Sequence 1:NP_004307.2 Gene:ASCL1 / 429 HGNCID:738 Length:236 Species:Homo sapiens
Sequence 2:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster


Alignment Length:110 Identity:38/110 - (34%)
Similarity:53/110 - (48%) Gaps:30/110 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    70 ADGQ-----PSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERN 129
            |||:     ..|.|.|...||:      :|.:.| ||||              ||    |.|||.
  Fly   227 ADGENQDAAAGGSGKKRRGKQI------TPVVKR-KRRL--------------AA----NARERR 266

Human   130 RVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLL 174
            |::.:|..|..||:::|....::::||.|||:.|..||.||..||
  Fly   267 RMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASCL1NP_004307.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..98 9/32 (28%)
bHLH_TS_ASCL1_Mash1 115..185 CDD:381585 24/60 (40%)
atoNP_731223.1 bHLH_TS_amos_like 250..311 CDD:381558 28/79 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.