DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASCL1 and amos

DIOPT Version :10

Sequence 1:NP_004307.2 Gene:ASCL1 / 429 HGNCID:738 Length:236 Species:Homo sapiens
Sequence 2:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster


Alignment Length:137 Identity:40/137 - (29%)
Similarity:60/137 - (43%) Gaps:33/137 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    54 QQQQQQQQQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFS------------ 106
            |:|||...||         .|.|.....:|:...:|:.|.|     ..:|:.|            
  Fly    75 QEQQQHHLQA---------NPLGKNQGRSPRYWNKQQRSKP-----YDKLSTSMSSSTSSASSSS 125

Human   107 ----GFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYI 167
                |||..:.:::..|.   |.|||.|:..:|..|..||:.||:...::::||.|||:.|..||
  Fly   126 SSSAGFGGEVLKKRRLAA---NARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYI 187

Human   168 RALQQLL 174
            ..|..||
  Fly   188 GDLVTLL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASCL1NP_004307.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..98 12/43 (28%)
bHLH_TS_ASCL1_Mash1 115..185 CDD:381585 23/60 (38%)
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 24/66 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.