DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASCL1 and Hand

DIOPT Version :10

Sequence 1:NP_004307.2 Gene:ASCL1 / 429 HGNCID:738 Length:236 Species:Homo sapiens
Sequence 2:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster


Alignment Length:99 Identity:33/99 - (33%)
Similarity:51/99 - (51%) Gaps:16/99 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    80 KSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARR---NERERNRVKLVNLGFATL 141
            |.:..||::|            ..|.|..|| :|......|.:|   |::||.|.:.:|..|:.|
  Fly    30 KHSESQVQQQ------------IYNTSHLGY-VPTSNTRIVKKRNTANKKERRRTQSINNAFSYL 81

Human   142 REHVPNGAANKKMSKVETLRSAVEYIRALQQLLD 175
            ||.:||...:.|:||::||:.|:.||..|..:||
  Fly    82 REKIPNVPTDTKLSKIKTLKLAILYINYLVNVLD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASCL1NP_004307.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..98 4/17 (24%)
bHLH_TS_ASCL1_Mash1 115..185 CDD:381585 24/64 (38%)
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 21/54 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.