DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ASCL1 and CG33557

DIOPT Version :9

Sequence 1:	NP_004307.2	Gene:	ASCL1 / 429	HGNCID:	738	Length:	236	Species:	Homo sapiens
Sequence 2:	NP_001014730.1	Gene:	CG33557 / 3346145	FlyBaseID:	FBgn0053557	Length:	150	Species:	Drosophila melanogaster

Alignment Length:	140	Identity:	35/140 - (25%)
Similarity:	52/140 - (37%)	Gaps:	45/140 - (32%)

- Green bases have known domain annotations that are detailed below.

Human    36 AAAAAAAAAAAAQSAQQQQQQQQQQQQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCK 100
            ::.:|:.:.|||.|...|..|:..          ..||.:.|.|:..|
  Fly    24 SSGSASGSGAAADSEDSQIGQEAN----------PGGQENQGNHRRRP----------------- 61

Human   101 RRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVE 165
                        |:|      :.|.|||.|...||..:..||..:|....|:|:||:|.:|.|..
  Fly    62 ------------PRQ------KINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASS 108

Human   166 YIRALQQLLD 175
            ||..|...|:
  Fly   109 YITHLSSTLE 118

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ASCL1	NP_004307.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..26
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	42..98		11/55 (20%)
		bHLH_TS_ASCL1_Mash1	115..185	CDD:381585	22/61 (36%)
CG33557	NP_001014730.1	HLH	67..119	CDD:197674	21/52 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4029
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810