| Sequence 1: | NP_004307.2 | Gene: | ASCL1 / 429 | HGNCID: | 738 | Length: | 236 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001259243.1 | Gene: | HLH4C / 31397 | FlyBaseID: | FBgn0011277 | Length: | 191 | Species: | Drosophila melanogaster |
| Alignment Length: | 50 | Identity: | 22/50 - (44%) |
|---|---|---|---|
| Similarity: | 33/50 - (66%) | Gaps: | 0/50 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Human 126 RERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLD 175 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ASCL1 | NP_004307.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..26 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 42..98 | ||||
| bHLH_TS_ASCL1_Mash1 | 115..185 | CDD:381585 | 22/49 (45%) | ||
| HLH4C | NP_001259243.1 | bHLH_TS_HEN1 | 105..165 | CDD:381544 | 21/48 (44%) |
| Blue background indicates that the domain is not in the aligned region. | |||||