DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASCL1 and HLH4C

DIOPT Version :10

Sequence 1:NP_004307.2 Gene:ASCL1 / 429 HGNCID:738 Length:236 Species:Homo sapiens
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:50 Identity:22/50 - (44%)
Similarity:33/50 - (66%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   126 RERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLD 175
            |||.||:..|:.||.||:.:|....:||:||:|.|:.|:.||..|..:|:
  Fly   116 RERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVLE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASCL1NP_004307.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..98
bHLH_TS_ASCL1_Mash1 115..185 CDD:381585 22/49 (45%)
HLH4CNP_001259243.1 bHLH_TS_HEN1 105..165 CDD:381544 21/48 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.