DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASCL1 and l(1)sc

DIOPT Version :9

Sequence 1:NP_004307.2 Gene:ASCL1 / 429 HGNCID:738 Length:236 Species:Homo sapiens
Sequence 2:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster


Alignment Length:240 Identity:79/240 - (32%)
Similarity:108/240 - (45%) Gaps:67/240 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    51 QQQQQQQQQQQQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQ 115
            |...|.||.|..||:: |....|...       .|..:|.:..|.|...|::.|::...|.   :
  Fly    27 QHHHQTQQHQLIAPKI-PLGTSQLQN-------MQQSQQSNVGPMLSSQKKKFNYNNMPYG---E 80

Human   116 QPAAVARRNERERNRVKLVNLGFATLREHVP--------NG--AANKKMSKVETLRSAVEYIRAL 170
            |..:|||||.|||||||.||.||..||:|:|        ||  .::||:|||:|||.||||||.|
  Fly    81 QLPSVARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGL 145

Human   171 QQLLDEHDAVSA--AFQAGVLSPTISPNYSNDLNSM---------------------AGSPVSSY 212
            |.:||:..|.|.  .:.:...|.....:| ||.|..                     :.||..||
  Fly   146 QDMLDDGTASSTRHIYNSADESSNDGSSY-NDYNDSLDSSQQFLTGATQSAQSHSYHSASPTPSY 209

Human   213 SSDE------------------GSYDPLS---PEEQELLDF-TNW 235
            |..|                  .|:|..|   |:::||||: ::|
  Fly   210 SGSEISGGGYIKQELQEQDLKFDSFDSFSDEQPDDEELLDYISSW 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASCL1NP_004307.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..98 13/46 (28%)
bHLH_TS_ASCL1_Mash1 115..185 CDD:381585 43/81 (53%)
l(1)scNP_476623.1 HLH <96..146 CDD:278439 26/49 (53%)
Peptidase_C11 <128..218 CDD:304483 30/90 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9706
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5142
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - otm41464
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13935
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 1 1.000 - - X2717
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.960

Return to query results.
Submit another query.