DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASCL1 and ac

DIOPT Version :9

Sequence 1:NP_004307.2 Gene:ASCL1 / 429 HGNCID:738 Length:236 Species:Homo sapiens
Sequence 2:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster


Alignment Length:173 Identity:57/173 - (32%)
Similarity:81/173 - (46%) Gaps:56/173 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   119 AVARRNERERNRVKLVNLGFATLREHVP--------NG------AANKKMSKVETLRSAVEYIRA 169
            :|.|||.|||||||.||.||:.||:|:|        ||      .||||:|||.||:.||||||.
  Fly    25 SVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRR 89

Human   170 LQQLLDEHDAVSAA----------FQ--------------AGVLSPTISPNYSNDLNSM------ 204
            ||::|.|:|.....          ||              ..:.|||.|.:..|.::|.      
  Fly    90 LQKVLHENDQQKQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCKPATS 154

Human   205 ----AGSPVSSYSSDEGSYDPL-------SPEEQELLDFTN-W 235
                |..|.:.::..|.|::..       ..|::::||:.: |
  Fly   155 TIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLW 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASCL1NP_004307.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..98
bHLH_TS_ASCL1_Mash1 115..185 CDD:381585 41/89 (46%)
acNP_476824.1 HLH 30..96 CDD:197674 36/65 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158182
Domainoid 1 1.000 68 1.000 Domainoid score I9706
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5142
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - otm41464
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 1 1.000 - - X2717
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.