DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASCL1 and Fer1

DIOPT Version :9

Sequence 1:NP_004307.2 Gene:ASCL1 / 429 HGNCID:738 Length:236 Species:Homo sapiens
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:231 Identity:49/231 - (21%)
Similarity:86/231 - (37%) Gaps:57/231 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    31 FFATAAAAAAAAAAAAAQSAQQQQQQQQQQQQAPQLRPAADGQPSGGGHKSAPKQVKR------Q 89
            ||..:.|..|:.:::......:...:...:..|           ...|..|..:..::      :
  Fly    17 FFEGSQATNASTSSSDYFFGDEHSSESDDEDDA-----------YSSGFNSDQENTEKTFCPFSR 70

Human    90 RSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAANKKM 154
            ||..|..::|..:         :.||:.||    |.|||.|::.:|..|..||.|:|.....|::
  Fly    71 RSHKPRRLKCASQ---------MAQQRQAA----NLRERRRMQSINEAFEGLRTHIPTLPYEKRL 122

Human   155 SKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSND------LNSMAGSPVSS-- 211
            |||:||:.|:.||..|.:::.:.   ....:.|:   ::..||..:      |....|....|  
  Fly   123 SKVDTLKLAISYITFLSEMVKKD---KNGNEPGL---SLQRNYQKEPPKKIILKDRTGGVAHSLS 181

Human   212 -------------YSSDEGSYDPLSPEEQELLDFTN 234
                         |:......||..|..|.|..:.|
  Fly   182 WYRKGDRYPGSKLYARTWTPEDPRGPHSQPLPLYNN 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASCL1NP_004307.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..98 6/61 (10%)
bHLH_TS_ASCL1_Mash1 115..185 CDD:381585 24/69 (35%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 21/51 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.