Sequence 1: | NP_004307.2 | Gene: | ASCL1 / 429 | HGNCID: | 738 | Length: | 236 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262334.1 | Gene: | Fer1 / 2768661 | FlyBaseID: | FBgn0037475 | Length: | 256 | Species: | Drosophila melanogaster |
Alignment Length: | 231 | Identity: | 49/231 - (21%) |
---|---|---|---|
Similarity: | 86/231 - (37%) | Gaps: | 57/231 - (24%) |
- Green bases have known domain annotations that are detailed below.
Human 31 FFATAAAAAAAAAAAAAQSAQQQQQQQQQQQQAPQLRPAADGQPSGGGHKSAPKQVKR------Q 89
Human 90 RSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAANKKM 154
Human 155 SKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSND------LNSMAGSPVSS-- 211
Human 212 -------------YSSDEGSYDPLSPEEQELLDFTN 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ASCL1 | NP_004307.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..26 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 42..98 | 6/61 (10%) | |||
bHLH_TS_ASCL1_Mash1 | 115..185 | CDD:381585 | 24/69 (35%) | ||
Fer1 | NP_001262334.1 | HLH | 92..144 | CDD:197674 | 21/51 (41%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |