DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and Bmp1

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_112613.1 Gene:Bmp1 / 83470 RGDID:620739 Length:990 Species:Rattus norvegicus


Alignment Length:329 Identity:95/329 - (28%)
Similarity:141/329 - (42%) Gaps:67/329 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLLIIL-----GISLGD-SMPLEDMDSQEMIDLTD-------LGDTLFGNPD-----VETTGAL 57
            ||||::|     .:.|.| :..|.:.|:.|:::..|       |||......|     |:....|
  Rat    16 LLLLLLLPRAGRPLDLADYTYDLGEEDAPELLNYKDPCKAAAFLGDIALDEEDLRAFRVQQAAVL 80

  Fly    58 ---------VEALGVESPLNPEEL-GTYHEGDILIPLSYRDARFNGTRNGILALSSR----WPGG 108
                     ::|.|..|.|..:.. |....|.        ..|:........|.:||    ||.|
  Rat    81 RQQTAQRSSIKAAGNSSALGRQSTSGQPQRGS--------RGRWRSRPRSRRAATSRPERVWPDG 137

  Fly   109 VVPYEIKGPFTSQELGNINHAFKEYHTKTCVRFKPRTTEKDYISIGSGKSGCWSSIGRLGGRQEV 173
            |:|:.|.|.||..:......|.:.:...|||.|..||.|..||.......||.|.:||.||..:.
  Rat   138 VIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQA 202

  Fly   174 NLQSPNCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGV 238
            .....||.: :|..:|||.|.:||:||..|.:||.:|.::::||:|....||.|...:.....|.
  Rat   203 ISIGKNCDK-FGIVVHELGHVIGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEVQEVESLGE 266

  Fly   239 EYDYGSVMHYSPTSFTR-------------NG-QPTLKALRATSDASQMGQRKGFSAGDVRKINA 289
            .||:.|:|||:..:|:|             || :|::            |||...|.||:.:...
  Rat   267 TYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPSI------------GQRTRLSKGDIAQARK 319

  Fly   290 MYKC 293
            :|||
  Rat   320 LYKC 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 69/208 (33%)
ZnMc_astacin_like 107..291 CDD:239807 63/197 (32%)
Bmp1NP_112613.1 ZnMc_BMP1_TLD 125..324 CDD:239808 71/212 (33%)
Astacin 132..325 CDD:279708 68/205 (33%)
CUB 326..435 CDD:278839
CUB 439..548 CDD:278839
FXa_inhibition 559..591 CDD:291342
CUB 595..704 CDD:278839
FXa_inhibition 711..746 CDD:291342
CUB 751..860 CDD:278839
CUB 864..977 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.