DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and LOC797085

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001373298.1 Gene:LOC797085 / 797085 -ID:- Length:285 Species:Danio rerio


Alignment Length:238 Identity:80/238 - (33%)
Similarity:116/238 - (48%) Gaps:34/238 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ESPLNPEELGTYHEGDILIPLSYRDARFNGTRNGILALSSRWP---GGV-VPYEIKGPFTSQELG 124
            |:||...:.|...|.:.:||.:.|:|.           :..||   |.| |||.|.... ..:.|
Zfish    72 ETPLVDSDEGYALEEEDIIPQTDRNAG-----------NHLWPEKDGEVSVPYSIASGL-EDKTG 124

  Fly   125 NINHAFKEYHTKTCVRFKPRTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIH 189
            :|..|.|....||||:|...|||:||:.....:. |.|.:|..||.|.: |..|.|  ..|...|
Zfish   125 HILAALKMVSKKTCVKFHHHTTEEDYLHFKPDRM-CASLVGCAGGEQPI-LVGPKC--NAGNICH 185

  Fly   190 ELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFT 254
            |::|:||.:||.:|.:||.|:.::.|||.|....||:.....|   .|:|||..|::||....|:
Zfish   186 EILHSLGLYHEHSRPDRDKYITILYDNIMPGKESNFKVKKGNT---LGLEYDLDSILHYGDDCFS 247

  Fly   255 RNGQPTL----KALRATSDASQMGQRKGFSAGDVRKINAMYKC 293
            |||..|:    |.::       :|||...|..||.::..:|.|
Zfish   248 RNGNHTIIPKKKGVK-------IGQRTHMSVLDVERLRRLYHC 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 71/198 (36%)
ZnMc_astacin_like 107..291 CDD:239807 67/188 (36%)
LOC797085NP_001373298.1 ZnMc_astacin_like 111..281 CDD:239807 65/184 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.