DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and c6ast1

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001036784.1 Gene:c6ast1 / 751088 ZFINID:ZDB-GENE-070621-1 Length:260 Species:Danio rerio


Alignment Length:255 Identity:92/255 - (36%)
Similarity:131/255 - (51%) Gaps:35/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DVETTGALVEALGVESPLN--PEELG--TYHEGDILIPLSYRDARFNGTRNGILA----LSSRWP 106
            |:.:..||     :|.|.|  .|||.  :...|||.:          ||...|.|    .|.:||
Zfish    24 DIISASAL-----MERPSNFAGEELDEPSIMFGDIAV----------GTPLDITAPCTGQSCKWP 73

  Fly   107 ----GGV-VPYEIKGPFTSQELGNINHAFKEYHTKTCVRFKPRTTEKDYISIGSGKSGCWSSIGR 166
                |.| |||.|...:::||...|...|:.....|||||:||||::|||:| ...|||:|.:||
Zfish    74 LSSNGKVFVPYIISDEYSTQEKDVIFQGFRSLEKSTCVRFRPRTTQRDYINI-EPNSGCYSFVGR 137

  Fly   167 LGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSR 231
            ..|.|.|:|....|:: .....|||:|.|||.||.||.:|||:|:::..||.|....||:|..:.
Zfish   138 RTGGQTVSLDHDGCIK-LNIVQHELLHTLGFHHEHNRSDRDSHVQIVYKNIIPGQERNFDKIKTN 201

  Fly   232 TQYGFGVEYDYGSVMHYSPTSFTRNGQPTLKALRATSDASQMGQRKGFSAGDVRKINAMY 291
               .....|||.|||||...:|::|.:.|:..:  ......:|:.|..|:.|:.:||.:|
Zfish   202 ---NLETAYDYSSVMHYGRFAFSKNKEATIVPI--PDSGVTIGRAKRMSSNDILRINRLY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 75/193 (39%)
ZnMc_astacin_like 107..291 CDD:239807 72/184 (39%)
c6ast1NP_001036784.1 Astacin 71..259 CDD:279708 75/193 (39%)
ZnMc_hatching_enzyme 77..257 CDD:239810 73/187 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595463
Domainoid 1 1.000 165 1.000 Domainoid score I3861
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 167 1.000 Inparanoid score I4142
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm6586
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.