DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and Tll1

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001099551.1 Gene:Tll1 / 678743 RGDID:1306120 Length:1013 Species:Rattus norvegicus


Alignment Length:203 Identity:71/203 - (34%)
Similarity:108/203 - (53%) Gaps:13/203 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 ALSSR----WPGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCVRFKPRTTEKDYISIGSGKSGC 160
            |.:||    |||||:||.|.|.||..:......|.:.:...|||.|..|:.|:.||.......||
  Rat   148 AATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFTERSDEESYIVFTYRPCGC 212

  Fly   161 WSSIGRLG-GRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVN 224
            .|.:||.| |.|.::: ..||.: :|..:|||.|.:||:||..|.:||::|.::::||:|....|
  Rat   213 CSYVGRRGNGPQAISI-GKNCDK-FGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYN 275

  Fly   225 FEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTLKALRATSDAS----QMGQRKGFSAGDVR 285
            |.|.........|..||:.|:|||:..:|:|.  ..|..:..:.|.:    .:|||...|.||:.
  Rat   276 FLKMEPGEVNSLGERYDFDSIMHYARNTFSRG--MFLDTILPSRDDNGIRPAIGQRTRLSKGDIA 338

  Fly   286 KINAMYKC 293
            :...:|:|
  Rat   339 QARKLYRC 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 69/199 (35%)
ZnMc_astacin_like 107..291 CDD:239807 64/188 (34%)
Tll1NP_001099551.1 ZnMc_BMP1_TLD 148..347 CDD:239808 71/203 (35%)
Astacin 155..348 CDD:279708 68/196 (35%)
CUB 349..458 CDD:278839
CUB 462..571 CDD:278839
FXa_inhibition 582..614 CDD:291342
CUB 618..727 CDD:278839
FXa_inhibition 734..769 CDD:291342
CUB 774..883 CDD:278839
CUB 887..1000 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.