Sequence 1: | NP_651242.1 | Gene: | CG5715 / 42895 | FlyBaseID: | FBgn0039180 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001099551.1 | Gene: | Tll1 / 678743 | RGDID: | 1306120 | Length: | 1013 | Species: | Rattus norvegicus |
Alignment Length: | 203 | Identity: | 71/203 - (34%) |
---|---|---|---|
Similarity: | 108/203 - (53%) | Gaps: | 13/203 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 100 ALSSR----WPGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCVRFKPRTTEKDYISIGSGKSGC 160
Fly 161 WSSIGRLG-GRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVN 224
Fly 225 FEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTLKALRATSDAS----QMGQRKGFSAGDVR 285
Fly 286 KINAMYKC 293 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5715 | NP_651242.1 | Astacin | 104..295 | CDD:279708 | 69/199 (35%) |
ZnMc_astacin_like | 107..291 | CDD:239807 | 64/188 (34%) | ||
Tll1 | NP_001099551.1 | ZnMc_BMP1_TLD | 148..347 | CDD:239808 | 71/203 (35%) |
Astacin | 155..348 | CDD:279708 | 68/196 (35%) | ||
CUB | 349..458 | CDD:278839 | |||
CUB | 462..571 | CDD:278839 | |||
FXa_inhibition | 582..614 | CDD:291342 | |||
CUB | 618..727 | CDD:278839 | |||
FXa_inhibition | 734..769 | CDD:291342 | |||
CUB | 774..883 | CDD:278839 | |||
CUB | 887..1000 | CDD:278839 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |