DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and BMP1

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_006120.1 Gene:BMP1 / 649 HGNCID:1067 Length:986 Species:Homo sapiens


Alignment Length:222 Identity:73/222 - (32%)
Similarity:105/222 - (47%) Gaps:31/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 RFNGTRNGILALSSR----WPGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCVRFKPRTTEKDY 150
            |:.|......|.:||    ||.||:|:.|.|.||..:......|.:.:...|||.|..||.|..|
Human   111 RWRGRSRSRRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSY 175

  Fly   151 ISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKD 215
            |.......||.|.:||.||..:......||.: :|..:|||.|.:||:||..|.:||.:|.::::
Human   176 IVFTYRPCGCCSYVGRRGGGPQAISIGKNCDK-FGIVVHELGHVVGFWHEHTRPDRDRHVSIVRE 239

  Fly   216 NIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTR-------------NG-QPTLKALRA 266
            ||:|....||.|...:.....|..||:.|:|||:..:|:|             || :|.:     
Human   240 NIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPI----- 299

  Fly   267 TSDASQMGQRKGFSAGDVRKINAMYKC 293
                   |||...|.||:.:...:|||
Human   300 -------GQRTRLSKGDIAQARKLYKC 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 69/208 (33%)
ZnMc_astacin_like 107..291 CDD:239807 63/197 (32%)
BMP1NP_006120.1 ZnMc_BMP1_TLD 121..320 CDD:239808 71/212 (33%)
Astacin 128..321 CDD:279708 68/205 (33%)
CUB 322..431 CDD:278839
CUB 435..544 CDD:278839
FXa_inhibition 555..587 CDD:291342
CUB 591..700 CDD:278839
FXa_inhibition 707..742 CDD:291342
CUB 747..856 CDD:278839
CUB 860..973 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.