DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and astl2c

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001037864.1 Gene:astl2c / 594901 XenbaseID:XB-GENE-6449741 Length:496 Species:Xenopus tropicalis


Alignment Length:296 Identity:101/296 - (34%)
Similarity:145/296 - (48%) Gaps:35/296 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NNTGSLLLLIILGISLGDSMPLEDMDSQEMIDLTDLGDTLFGNPDVETTGALVEALGVESPLNPE 70
            ::|.|.:||..|.: ...|.|:     |.:....:..||...:.|.:..|.::.|       |..
 Frog     2 SSTISFILLFGLFV-CATSFPI-----QIVFPHVEQNDTEVPDNDDDVFGRILRA-------NKG 53

  Fly    71 ELGTYHEGDILIPLSYRDARFNGTRNGILALSSRWP---GGV--VPYEIKGPFTSQELGNINHAF 130
            :...:.:|||....|         |:.|......||   .|:  |||.|...::..|...|..|.
 Frog    54 KRNFHVQGDIAHKFS---------RSAINCKECLWPKDSNGIVNVPYTISSDYSQNEASLIMAAM 109

  Fly   131 KEYHTKTCVRFKPRTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHAL 195
            :|:.|.|||:|.|:|.|.|||:| ....||||.||..||.|:|:|....|: .||...|||.|.|
 Frog   110 QEFATLTCVQFIPQTDEDDYIAI-QPLDGCWSYIGVNGGAQQVSLGKGGCI-YYGVIQHELNHVL 172

  Fly   196 GFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTR-NGQP 259
            ||.||.:|.:||:||.:....|.|:.:..|:|..:.   ..|:||||.|||||...|::. .|:.
 Frog   173 GFVHEHSRSDRDNYVHINYQYISPDNIAFFDKKDTD---NLGLEYDYSSVMHYPGYSYSNTTGKN 234

  Fly   260 TLKALRATSDASQMGQRKGFSAGDVRKINAMYKCKV 295
            |:..:...:  ..:|||.|.|..||.|||.:|:|.|
 Frog   235 TIVPIPNAN--VPIGQRYGLSTLDVSKINRLYQCDV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 80/196 (41%)
ZnMc_astacin_like 107..291 CDD:239807 76/186 (41%)
astl2cNP_001037864.1 ZnMc_hatching_enzyme 84..266 CDD:239810 77/188 (41%)
Astacin 89..266 CDD:279708 76/183 (42%)
CUB 270..380 CDD:238001
CUB 383..495 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.