DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and mep1a.2

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001122199.1 Gene:mep1a.2 / 565535 ZFINID:ZDB-GENE-041001-208 Length:689 Species:Danio rerio


Alignment Length:221 Identity:84/221 - (38%)
Similarity:109/221 - (49%) Gaps:21/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EGDILIPLSYRDARFNGTRNGILALSSRW--PGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCV 139
            ||||.     .|.|    ||.|:...:||  |   :||.:.........|.|..|.:.|..|:||
Zfish    51 EGDIA-----GDPR----RNAIIDEKARWQFP---IPYILTDTLDLNAKGVILQALEMYRLKSCV 103

  Fly   140 RFKPRTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRH 204
            .|||...|..|||. :...||||.:|.|...|.|:: ...| .|.....|||:|||||:|||:|.
Zfish   104 DFKPYEGESTYISF-TKLDGCWSFVGDLKTGQNVSI-GERC-DTKAIVEHELLHALGFYHEQSRS 165

  Fly   205 ERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTLKALRATSD 269
            :||.||::..|.|......||.|............|||.|:|||.|.||  |..|.:..:..|..
Zfish   166 DRDDYVKIWWDQIIEGKEHNFNKYEDDFITDLNTPYDYESIMHYRPLSF--NKDPDIPTITTTIP 228

  Fly   270 A--SQMGQRKGFSAGDVRKINAMYKC 293
            |  :.:|||..|||.|:.::|.||:|
Zfish   229 AFNNIIGQRLDFSALDLERLNRMYEC 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 75/194 (39%)
ZnMc_astacin_like 107..291 CDD:239807 69/185 (37%)
mep1a.2NP_001122199.1 ZnMc 26..254 CDD:294052 83/219 (38%)
Astacin 68..256 CDD:279708 75/195 (38%)
MAM 259..423 CDD:214533
MAM 264..423 CDD:99706
MATH 423..579 CDD:295307
EGF 619..653 CDD:278437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25214
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.