DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and hce2l1

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_009302797.1 Gene:hce2l1 / 564183 ZFINID:ZDB-GENE-070912-147 Length:232 Species:Danio rerio


Alignment Length:224 Identity:87/224 - (38%)
Similarity:119/224 - (53%) Gaps:23/224 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EGDILIPLSYRDARFNGTRNGILAL--SSRWPGGV-----VPYEIKGPFTSQELGNINHAFKEYH 134
            |||||.|         |:|:.|..|  |.|||..|     |||.:...:...:...|.....:..
Zfish    21 EGDILSP---------GSRSAITCLGDSCRWPKAVDGFVYVPYIMSTLYDDMDRITIETGMLDIS 76

  Fly   135 TKTCVRFKPRTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFH 199
            :.|||:|.|||.:.::::| ..:.||||.:|..||.|.|:||||.|:.: |...|||||||||.|
Zfish    77 SSTCVKFVPRTHQANFLNI-QPRYGCWSYLGMTGGSQTVSLQSPGCMWS-GVASHELMHALGFVH 139

  Fly   200 EQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTLKAL 264
            ||:|.:||.||.::.:||......||.|..:.   .....|||.|||||...:|:.:|.||:  :
Zfish   140 EQSRSDRDRYVSILWENIIENQRHNFRKYETN---NLNTAYDYSSVMHYGRYAFSEDGGPTI--I 199

  Fly   265 RATSDASQMGQRKGFSAGDVRKINAMYKC 293
            ........:|||.|.|..|:.|||.:|.|
Zfish   200 PKPDPYIPIGQRDGPSILDIHKINILYNC 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 76/195 (39%)
ZnMc_astacin_like 107..291 CDD:239807 71/188 (38%)
hce2l1XP_009302797.1 Astacin 41..229 CDD:279708 76/195 (39%)
ZnMc_hatching_enzyme 47..228 CDD:239810 71/187 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 165 1.000 Domainoid score I3861
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 167 1.000 Inparanoid score I4142
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm6586
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.