DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and cuzd1.2

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_021323075.1 Gene:cuzd1.2 / 555768 ZFINID:ZDB-GENE-131119-30 Length:718 Species:Danio rerio


Alignment Length:164 Identity:39/164 - (23%)
Similarity:66/164 - (40%) Gaps:47/164 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 ELGNI---NHAFKEYHTKTCVRFKPRTTEKDYISIGSG-KSGCWSSIGRLGGRQEVNLQSPNCL- 181
            :|||:   :...:.:|:.:  |:.......|:..:..| |:...||:....||  |:..|.|.: 
Zfish   397 QLGNVCFNDTTHQAFHSTS--RYLTVVFRSDFSGVSHGFKAHFTSSLTADQGR--VDCSSDNMVI 457

  Fly   182 ---RTYGTPIHELMHALGFFHEQNRHERDSYV--RVMKDNI-KPEMMVNFEKSSSRTQYGFGVEY 240
               |:|       :::|||      ...|.||  |:.:.|| ..|::..|..::..|        
Zfish   458 VLRRSY-------LNSLGF------SGNDLYVDDRLCRPNISSTEVVFRFPLNTCGT-------- 501

  Fly   241 DYGSVMHYSPTSFTRNGQPTLKALRATSDASQMG 274
              ...|..|..|:|.|       :||:  .||.|
Zfish   502 --AKKMMNSFVSYTNN-------VRAS--PSQSG 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 39/164 (24%)
ZnMc_astacin_like 107..291 CDD:239807 39/164 (24%)
cuzd1.2XP_021323075.1 CUB 21..127 CDD:238001
Somatomedin_B 131..164 CDD:307259
Somatomedin_B 175..214 CDD:321959
Somatomedin_B <239..260 CDD:307259
CUB 330..439 CDD:238001 8/43 (19%)
ZP 450..694 CDD:214579 26/107 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.