DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and mep1a.1

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001025452.1 Gene:mep1a.1 / 553530 ZFINID:ZDB-GENE-041001-209 Length:598 Species:Danio rerio


Alignment Length:224 Identity:79/224 - (35%)
Similarity:110/224 - (49%) Gaps:27/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EGDILIPLSYRDARFNGTRNGILALSSRW--PGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCV 139
            ||||.:|..         |.|::..:.||  |   :||.:.........|.|..||:.|..|:||
Zfish    48 EGDIALPPG---------RIGLINTTYRWKFP---IPYILSDSLDLNAKGAIYQAFEVYRLKSCV 100

  Fly   140 RFKPRTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPI-HELMHALGFFHEQNR 203
            .|||...||.||....| .||||.:|.....|.::| .|.|  .:...| |||:|||||:|.|:|
Zfish   101 DFKPYEGEKTYIKFEKG-DGCWSFVGDQQNGQVLSL-GPGC--DHKAVIEHELLHALGFYHMQSR 161

  Fly   204 HERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTLKALRATS 268
            .:||.||::..|.:...:..||.|............|||.|||||.|.:|  |..|::..:  |:
Zfish   162 QDRDDYVKIWLDQVIEGLEHNFNKYDDSFVTDLNTPYDYESVMHYRPFAF--NKDPSIPTI--TT 222

  Fly   269 DASQ----MGQRKGFSAGDVRKINAMYKC 293
            :..:    :||...||..|:.::|.||.|
Zfish   223 NIPEFYKIIGQYLDFSEMDIVRLNRMYNC 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 72/197 (37%)
ZnMc_astacin_like 107..291 CDD:239807 66/188 (35%)
mep1a.1NP_001025452.1 ZnMc 26..251 CDD:294052 78/222 (35%)
Astacin 65..253 CDD:279708 72/198 (36%)
MAM 261..420 CDD:279023
MAM 261..419 CDD:99706
MATH 419..582 CDD:295307
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25214
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.