DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and tll2l

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001016661.1 Gene:tll2l / 549415 XenbaseID:XB-GENE-478930 Length:500 Species:Xenopus tropicalis


Alignment Length:288 Identity:99/288 - (34%)
Similarity:149/288 - (51%) Gaps:32/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LIILGISLGDSMPLEDMDSQEMIDLTDLGDTLFGNPDVETTGALVEALGVESPLNPEELGTYHEG 78
            :||..::...|:||..:  ::.::..|..:|...|.....|..:....|::..|        .:|
 Frog     9 IIICLVTYATSLPLTTL--EKPLESDDHQETHKPNDADIFTQIIASNEGIDQLL--------LQG 63

  Fly    79 DILIPLSYRDARFNGTRNGILALSSRWP----GGV-VPYEIKGPFTSQELGNINHAFKEYHTKTC 138
            ||.|.:         .|:.:...:.:|.    |.| ||:.:...:|..:|..|..|.:|:.|.||
 Frog    64 DIAIRV---------VRSSLQCDNCKWDISSNGKVPVPFTVSPGYTKSQLALITAAMQEFETLTC 119

  Fly   139 VRFKPRTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNR 203
            |.|.|:|.||:.|:|.:| :||||.|||.||.|:|:|...:|: ..|...|||.|.|||.||..|
 Frog   120 VDFVPKTNEKNVININNG-NGCWSYIGRSGGVQQVSLSKQSCM-VKGIIQHELNHVLGFVHEHVR 182

  Fly   204 HERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTLKALRATS 268
            .:||.||.|:|.||.|:.:.||:.:.:.   ..|:.|||.|||||...:|:.:  |.|..|....
 Frog   183 SDRDQYVNVVKKNILPDSLGNFDIAVTN---NLGLPYDYYSVMHYPRNAFSIS--PFLPTLITKP 242

  Fly   269 DAS-QMGQRKGFSAGDVRKINAMYKCKV 295
            |.: |:|||.|.:..|:.|||.:|.|.|
 Frog   243 DPTIQIGQRYGLTNLDIAKINKLYNCDV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 82/196 (42%)
ZnMc_astacin_like 107..291 CDD:239807 79/185 (43%)
tll2lNP_001016661.1 ZnMc_hatching_enzyme 86..268 CDD:239810 80/188 (43%)
CUB 272..382 CDD:238001
CUB 385..495 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.