DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and MEP1B

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_005916.2 Gene:MEP1B / 4225 HGNCID:7020 Length:701 Species:Homo sapiens


Alignment Length:282 Identity:99/282 - (35%)
Similarity:140/282 - (49%) Gaps:42/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLIILGISLGDSMPLEDMDSQEMIDLTDLGDTLFGNPDVETTGALVEALGVESPLNPEELGTYHE 77
            ||:|.|::..::..::....|::.|:.                   |.||::          ..|
Human    15 LLVISGLATPENFDVDGGMDQDIFDIN-------------------EGLGLD----------LFE 50

  Fly    78 GDILIPLSYRDARFNGTRNGILALSSRWPGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCVRFK 142
            |||.:..:.       .||.|:....||| ..:||.::........|.|.:||:.|..|||:.||
Human    51 GDIRLDRAQ-------IRNSIIGEKYRWP-HTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFK 107

  Fly   143 PRTTEKDYISIGSGKSGCWSSIG-RLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHER 206
            |...|.:|||:..| ||||||:| |..|:||::: ..||.| ..|..||.:|||||:|||:|.:|
Human   108 PWAGETNYISVFKG-SGCWSSVGNRRVGKQELSI-GANCDR-IATVQHEFLHALGFWHEQSRSDR 169

  Fly   207 DSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTLKALRATSDAS 271
            |.|||:|.|.|......||...|........|.|||.||||||.|:|....:||: ..|.:....
Human   170 DDYVRIMWDRILSGREHNFNTYSDDISDSLNVPYDYTSVMHYSKTAFQNGTEPTI-VTRISDFED 233

  Fly   272 QMGQRKGFSAGDVRKINAMYKC 293
            .:|||..||..|:.|:|.:|.|
Human   234 VIGQRMDFSDSDLLKLNQLYNC 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 83/191 (43%)
ZnMc_astacin_like 107..291 CDD:239807 78/184 (42%)
MEP1BNP_005916.2 ZnMc_meprin 26..255 CDD:239809 94/269 (35%)
Astacin 69..257 CDD:279708 83/192 (43%)
MAM 260..427 CDD:214533
MAM 265..427 CDD:99706
MATH 427..586 CDD:295307
Required for proteolytic processing 595..607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4542
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6346
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8634
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2664
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.