DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and MEP1A

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_011512930.1 Gene:MEP1A / 4224 HGNCID:7015 Length:774 Species:Homo sapiens


Alignment Length:221 Identity:81/221 - (36%)
Similarity:111/221 - (50%) Gaps:21/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EGDILIPLSYRDARFNGTRNGILALSSRW--PGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCV 139
            :||||:..|         |||:...::||  |   :||.:.........|.|.:||:.:..|:||
Human    84 QGDILLQKS---------RNGLRDPNTRWTFP---IPYILADNLGLNAKGAILYAFEMFRLKSCV 136

  Fly   140 RFKPRTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPI-HELMHALGFFHEQNR 203
            .|||...|..|| |.....||||.:|.....|.::: ...|  .|...| ||::|||||:|||:|
Human   137 DFKPYEGESSYI-IFQQFDGCWSEVGDQHVGQNISI-GQGC--AYKAIIEHEILHALGFYHEQSR 197

  Fly   204 HERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQ-PTLKALRAT 267
            .:||.||.:..|.|......||:.............|||.|:|||.|.||.:|.. ||:.| :..
Human   198 TDRDDYVNIWWDQILSGYQHNFDTYDDSLITDLNTPYDYESLMHYQPFSFNKNASVPTITA-KIP 261

  Fly   268 SDASQMGQRKGFSAGDVRKINAMYKC 293
            ...|.:|||..|||.|:.::|.||.|
Human   262 EFNSIIGQRLDFSAIDLERLNRMYNC 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 73/194 (38%)
ZnMc_astacin_like 107..291 CDD:239807 67/185 (36%)
MEP1AXP_011512930.1 ZnMc_meprin 58..287 CDD:239809 80/219 (37%)
Astacin 101..289 CDD:279708 73/195 (37%)
MAM 292..459 CDD:214533
MAM 297..459 CDD:99706
MATH_Meprin_Alpha 459..622 CDD:239752
EGF_CA 700..738 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4542
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8634
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.