DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and CG10280

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001246942.1 Gene:CG10280 / 40740 FlyBaseID:FBgn0037395 Length:362 Species:Drosophila melanogaster


Alignment Length:353 Identity:114/353 - (32%)
Similarity:169/353 - (47%) Gaps:78/353 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKSQNN------------------TGSLLLLIILGI-------------SLGDSMPLEDMDSQE 34
            :||.::|                  :||::||:.|.:             :|.:|..|.......
  Fly    10 VGKQRSNGNIVTAKPNPSSIMCAQLSGSVVLLVQLQVAVLLVALLVLSATTLSESAKLPVRQYPA 74

  Fly    35 MID-----LTDLGDTL---------FGNPDVETTGALVEALGVESPLNPEELGTYHEGDILI-PL 84
            .:|     .|.:.:.|         :| ||:..     :.||::   :||.:....:|||.| |.
  Fly    75 GVDFFEHEFTSVAEVLKPLSDEYDPYG-PDIGD-----DDLGID---DPETMPRLFQGDIAIDPY 130

  Fly    85 SYRDARF--NGTRNGILALSSRWPGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCVRFKPRTTE 147
            :|...|.  |..|:.    ...||.|.:|:||...:.:||...|..|.|.:::.|||.|.|...|
  Fly   131 TYITLRLGVNPMRHP----KRLWPNGTIPFEISPRYANQERQAIIQAVKTFNSLTCVHFVPYDGE 191

  Fly   148 -KDYISIG---SGKSGCWSSIGRLGGRQEVNLQSP-----NCLRTYGTPIHELMHALGFFHEQNR 203
             .||:.|.   .|..||||.:||.||.|.|:||.|     :|..:.|..:||||||:|.:|||:|
  Fly   192 VDDYLLIEPPLEGPQGCWSYVGRRGGEQVVSLQRPDENSAHCFSSEGRIMHELMHAIGIYHEQSR 256

  Fly   204 HERDSYVRVMKDNIKPEMMVNFE-KSSSRTQYGFGVEYDYGSVMHYSPTSFT-RNGQ-PTLKALR 265
            .:||::|::..|||.|....||: .|..:.:|.|  :|||.|||||....|: |.|: ||:..|:
  Fly   257 ADRDNFVKIHWDNIVPRFRKNFKLVSKKKGKYAF--DYDYNSVMHYGEFYFSKRKGEKPTMTPLQ 319

  Fly   266 ATSDASQMGQRKGFSAGDVRKINAMYKC 293
               ...::||||..|..|..|||.:|.|
  Fly   320 ---PGVRIGQRKTISKIDCLKINELYGC 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 84/202 (42%)
ZnMc_astacin_like 107..291 CDD:239807 80/195 (41%)
CG10280NP_001246942.1 Astacin 147..344 CDD:279708 83/201 (41%)
ZnMc_astacin_like 151..342 CDD:239807 80/195 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469482
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115954at6960
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm8881
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.