DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and Cubn2

DIOPT Version :10

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_729748.3 Gene:Cubn2 / 39334 FlyBaseID:FBgn0259140 Length:3613 Species:Drosophila melanogaster


Alignment Length:217 Identity:43/217 - (19%)
Similarity:73/217 - (33%) Gaps:83/217 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DMDSQEMIDLTDLGDT----LFGNPDVETTGALVEALGVESPLNPEELGTYHEGDILI------- 82
            |...::.|.:..||.|    ::.|.  .:.|.||.:..       ..:|...:||:|.       
  Fly   993 DFPGRKKISIHTLGPTPSISIYDNS--TSPGKLVNSYS-------GSVGDVFDGDLLTINLHTNW 1048

  Fly    83 -PLSYRDARFN--------GT---RNGILALSSRWP-----GGVVPYEIKGPFTSQELGNINHAF 130
             .|.....:|:        ||   |.|.:. |..||     ..:..:.::.|| ...:..:.|.|
  Fly  1049 PRLEIYSIQFDIVQQDSCGGTFTARFGYIK-SPNWPKNYGESQMCEWILRAPF-GHRIELVVHNF 1111

  Fly   131 KEYHTKTCVRFKPRTTEKDYISIGSGKSGCWSS--------------IGRLGGRQEVNLQSPNCL 181
                          |.|::|.|     :|||:.              |||..|.     :.|:.:
  Fly  1112 --------------TLEEEYSS-----TGCWTDWLEIRNGDSESSPLIGRYCGN-----EIPSRI 1152

  Fly   182 RTYGTPIH------ELMHALGF 197
            .::|..:|      :.|...||
  Fly  1153 PSFGNVLHLKFKSDDSMEEKGF 1174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 ZnMc_astacin_like 107..291 CDD:239807 21/111 (19%)
Cubn2NP_729748.3 cubilin_NTD 38..141 CDD:412063
EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 290..328 CDD:214542
EGF_CA 330..374 CDD:214542
EGF 427..455 CDD:394967
EGF_CA 462..496 CDD:238011
CUB 503..619 CDD:238001
CUB 624..738 CDD:238001
CUB 745..854 CDD:238001
CUB 857..963 CDD:238001
CUB 1066..1179 CDD:238001 28/135 (21%)
CUB 1185..1293 CDD:238001
CUB 1303..1406 CDD:238001
CUB 1411..1523 CDD:238001
CUB 1530..1648 CDD:238001
CUB 1754..1862 CDD:238001
CUB 1979..2091 CDD:238001
CUB 2210..2321 CDD:238001
CUB 2327..2441 CDD:238001
CUB 2688..2782 CDD:412131
CUB 2810..2911 CDD:238001
CUB 3029..3143 CDD:238001
CUB 3169..3249 CDD:412131
CUB 3499..3607 CDD:238001
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.