DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and CG11865

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster


Alignment Length:245 Identity:91/245 - (37%)
Similarity:131/245 - (53%) Gaps:19/245 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ALVEALGVESPLNPEELGTYHEGDILIPLSYRDARFNGTRNGILALS---SRWPGGVVPYEIKGP 117
            ||....|:.|..|........|.||:: :|.:...|.|...|.:..|   ..|.|..:.|...|.
  Fly     5 ALAVIFGLGSSANGRPSIKLQEDDIIL-ISEQLQYFEGNLEGRVVKSWSEYYWKGRTLVYSYAGG 68

  Fly   118 FTSQELGNINHAFKEYHTKTCVRFKPRTTE---KDYISIGSGKSGCWSSIGRLG-GRQEVNLQSP 178
            |:|.::.:|..|..|..:||||:|  |.||   :..:.|....|||||.:|.|| ..|.:||.| 
  Fly    69 FSSLDIASIESAMAEISSKTCVKF--RRTEYKREPQVVIQKEGSGCWSYVGYLGRADQTLNLGS- 130

  Fly   179 NCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFE--KSSSRTQYGFGVEYD 241
            .|: :..|..|||:|||||||..:..:||.|||:..|||:.....||:  :::..|.||||  ||
  Fly   131 GCM-SNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFG--YD 192

  Fly   242 YGSVMHYSPTSFTRNGQPTLKALRATSDASQMGQRKGFSAGDVRKINAMY 291
            |.|:|||.|.:|::|||.|:..|::   .:::||....|..||:.:..||
  Fly   193 YDSIMHYGPFAFSKNGQSTIVPLKS---HAKIGQATQMSPKDVQTLKRMY 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 78/194 (40%)
ZnMc_astacin_like 107..291 CDD:239807 75/189 (40%)
CG11865NP_609759.1 Astacin 56..239 CDD:279708 76/191 (40%)
ZnMc_astacin_like 58..239 CDD:239807 75/189 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444818
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115954at6960
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.