DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and Adgrg6

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_218313.7 Gene:Adgrg6 / 308376 RGDID:1308551 Length:1248 Species:Rattus norvegicus


Alignment Length:232 Identity:49/232 - (21%)
Similarity:83/232 - (35%) Gaps:43/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKSQNNTGSLLLLIILGISLGDSMPLEDMDSQEMIDLTDLGDTL---FGNPDVETTGALVEALGV 63
            |..||.|.:.:..|:..:.       ..::.:|.||.| ||.||   |.|....:...|:|:   
  Rat   594 GDGQNLTSANINSIVEQVK-------RIVNKEENIDRT-LGSTLMNIFSNILSSSDSNLLES--- 647

  Fly    64 ESPLNPEELGTYHEGDILIPLSYRDARFNGTRNGILALSSRWPGGVVP--YEIKGPFTSQELGNI 126
                :.|.|.|..|....|.|:........|:|..|.:||..||...|  :.|..|..:.....:
  Rat   648 ----STEALKTIDELAFKIDLNSTPHVNIETQNLALGVSSLMPGTNAPSNFSIGLPSNNDSYFQM 708

  Fly   127 NHAFKEYHTKTCVRFKPRTTE----KDYISIGS------GKSGCWSSIG-------------RLG 168
            :....:......|...|...|    :|.|.:..      .|:|.:..:|             .:|
  Rat   709 DFENGQADPLASVILPPNLLENLSPEDSILVRRAQFTFFNKTGLFQDVGSQRKILVSYVMACSIG 773

  Fly   169 GRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHE 205
            .....||:.|..::...|...|:...:..|.:.|:::
  Rat   774 NITIQNLKDPVQIKIKHTRTQEVHQPICAFWDLNQNK 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 21/127 (17%)
ZnMc_astacin_like 107..291 CDD:239807 20/124 (16%)
Adgrg6XP_218313.7 CUB 38..146 CDD:238001
LamG 178..337 CDD:304605
GPS 799..844 CDD:280071 2/12 (17%)
7tm_4 861..1108 CDD:304433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.