DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and Mep1b

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_037315.1 Gene:Mep1b / 25727 RGDID:3081 Length:704 Species:Rattus norvegicus


Alignment Length:285 Identity:96/285 - (33%)
Similarity:142/285 - (49%) Gaps:49/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LIILGISLGDSMPLEDMD---SQEMIDLT-DLGDTLFGNPDVETTGALVEALGVESPLNPEELGT 74
            |::.|:...:.. ::|:|   .|::.|:. |||..||                            
  Rat    16 LLVSGLPAPEKF-VKDIDGGIDQDIFDINEDLGLDLF---------------------------- 51

  Fly    75 YHEGDILIPLSYRDARFNGTRNGILALSSRWPGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCV 139
              ||||.:..|        .||.|:..:.||| ..:||.::........|.|.:||:.|..|||:
  Rat    52 --EGDIKLEAS--------GRNSIIGDNYRWP-HTIPYVLEDSLEMNAKGVILNAFERYRLKTCI 105

  Fly   140 RFKPRTTEKDYISIGSGKSGCWSSIGRL-GGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNR 203
            .|||.:.|::|||:..| ||||||:|.: .|:||::: ..||.| ..|..||.:|||||:|||:|
  Rat   106 DFKPWSGEENYISVFKG-SGCWSSVGNIHAGKQELSI-GTNCDR-IATVQHEFLHALGFWHEQSR 167

  Fly   204 HERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTLKALRATS 268
            .:||.|:.::.|.|......||...:........|.|||.||||||.|:| :||..:....:.:.
  Rat   168 ADRDDYITIVWDRILSGKEHNFNIYNDSVSDSLNVPYDYTSVMHYSKTAF-QNGTESTIITKISD 231

  Fly   269 DASQMGQRKGFSAGDVRKINAMYKC 293
            ....:|||..||..|:.|:|.:|.|
  Rat   232 FEDVIGQRMDFSDYDLLKLNQLYSC 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 77/191 (40%)
ZnMc_astacin_like 107..291 CDD:239807 72/184 (39%)
Mep1bNP_037315.1 ZnMc 30..256 CDD:294052 93/268 (35%)
Astacin 70..258 CDD:279708 77/192 (40%)
MAM 266..430 CDD:279023
MAM 266..428 CDD:99706
MATH 428..586 CDD:295307
EGF_CA 609..647 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 149 1.000 Domainoid score I4301
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46226
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.