DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and Mep1a

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_037275.1 Gene:Mep1a / 25684 RGDID:3080 Length:748 Species:Rattus norvegicus


Alignment Length:221 Identity:84/221 - (38%)
Similarity:113/221 - (51%) Gaps:21/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EGDILIPLSYRDARFNGTRNGILALSSRW--PGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCV 139
            :||||:|         .|||.:...||||  |   :||.:.........|.|.:||:.:..|:||
  Rat    57 QGDILLP---------RTRNALRDPSSRWKPP---IPYILADNLDLNAKGAILNAFEMFRLKSCV 109

  Fly   140 RFKPRTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPI-HELMHALGFFHEQNR 203
            .|||...|..|| |....|||||.:|.....|.::: ...|  .|...| ||::|||||||||:|
  Rat   110 DFKPYEGESSYI-IFQQFSGCWSMVGDQHVGQNISI-GEGC--DYKAIIEHEILHALGFFHEQSR 170

  Fly   204 HERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQ-PTLKALRAT 267
            .:||.||.:..:.|..:...||.....:|.......|||.|:|||.|.||.:|.. ||:......
  Rat   171 TDRDDYVNIWWNEIMTDYEHNFNTYDDKTITDLNTPYDYESLMHYGPFSFNKNETIPTITTKIPE 235

  Fly   268 SDASQMGQRKGFSAGDVRKINAMYKC 293
            .:|. :|||..|||.|:.::|.||.|
  Rat   236 FNAI-IGQRLDFSATDLTRLNRMYNC 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 74/194 (38%)
ZnMc_astacin_like 107..291 CDD:239807 68/185 (37%)
Mep1aNP_037275.1 ZnMc 32..260 CDD:294052 83/219 (38%)
Astacin 75..261 CDD:279708 74/194 (38%)
MAM 270..433 CDD:279023
MAM 270..432 CDD:99706
MATH 432..596 CDD:295307
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 641..668
EGF 676..710 CDD:278437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 149 1.000 Domainoid score I4301
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46226
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.