DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and Adgrg6

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_006512741.1 Gene:Adgrg6 / 215798 MGIID:1916151 Length:1258 Species:Mus musculus


Alignment Length:232 Identity:49/232 - (21%)
Similarity:86/232 - (37%) Gaps:43/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKSQNNTGSLLLLIILGISLGDSMPLEDMDSQEMIDLTDLGDTL---FGNPDVETTGALVEALGV 63
            |..||.|.:.:..|:..:.       ..::.:|.||:| ||.||   |.|....:...|:|:   
Mouse   604 GDGQNLTSANINSIVEKVK-------RIVNKEENIDIT-LGSTLMNIFSNILSSSDSDLLES--- 657

  Fly    64 ESPLNPEELGTYHEGDILIPLSYRDARFNGTRNGILALSSRWPGGVVP--YEIKGPFTSQELGNI 126
                :.|.|.|..|....|.|:........|:|..|.:||..||...|  :.|..|..::....:
Mouse   658 ----STEALKTIDELAFKIDLNSTPHVNIETQNLALGVSSLIPGTNAPSNFSIGLPSNNESYFQM 718

  Fly   127 NHAFKEYHTKTCVRFKPRTTE----KDYISIGS------GKSGCWSSIG-------------RLG 168
            :....:......|...|...|    :|.:.:..      .|:|.:..:|             .:|
Mouse   719 DFGNGQTDPLASVILPPNLLENLSPEDSVLVRRAQFTFFNKTGLFQDVGSQRKVLVSYVMACSIG 783

  Fly   169 GRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHE 205
            .....||:.|..::...|...|:.|.:..|.:.|:::
Mouse   784 NITIQNLKDPVQIKIKHTRTQEVHHPICAFWDMNKNK 820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 21/127 (17%)
ZnMc_astacin_like 107..291 CDD:239807 20/124 (16%)
Adgrg6XP_006512741.1 CUB 48..156 CDD:238001
LamG 188..347 CDD:389952
HRM 543..588 CDD:382965
GPS 809..854 CDD:366827 2/12 (17%)
7tm_GPCRs 869..1137 CDD:391938
TM helix 1 871..896 CDD:341315
TM helix 2 906..928 CDD:341315
TM helix 3 939..966 CDD:341315
TM helix 4 981..997 CDD:341315
TM helix 5 1026..1049 CDD:341315
TM helix 6 1072..1097 CDD:341315
TM helix 7 1101..1126 CDD:341315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.