DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and nas-5

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_492616.1 Gene:nas-5 / 188819 WormBaseID:WBGene00003524 Length:360 Species:Caenorhabditis elegans


Alignment Length:305 Identity:95/305 - (31%)
Similarity:136/305 - (44%) Gaps:64/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLLIILGISLGDSMPLEDMDSQEMIDLTDLGDTLFGNPDVETTGALVEALGVESPLN------- 68
            |||.|||.:|:                             |...|..:...|.|:..:       
 Worm     6 LLLSIILTVSV-----------------------------VNGRGRRINIYGAENGKSDIVQLRG 41

  Fly    69 PEELGTYHEGDILIPLSYRDARFNGTRNGILALSS-RWP-------GGVVPYEIKGPFTSQELGN 125
            |.|...|..     |:..|...|   ||.:|:.|. ||.       ..::||.|.|.:.:.|...
 Worm    42 PAEQLVYSS-----PIRERRPIF---RNALLSNSPLRWSKMQDLDGNYLIPYVISGNYDTVERDT 98

  Fly   126 INHAFKEYHTKTCVRFKPRTTEKDYISIGSGK-SGCWSSIGRLGGRQEVNLQS---PNCLRTYGT 186
            |..|.::....||:|..|||.:.||..|.:.| .||::||||..|:..|.|:|   .:|::. .|
 Worm    99 IKTAMEKIANNTCIRLIPRTNQPDYAEINNKKGQGCYASIGRFPGKNVVMLESNDDQSCIQE-DT 162

  Fly   187 PIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPT 251
            .||||.|.:|.:||..|.:||:::.|:..||:|.....|||.|||....:.|.|||.|||||...
 Worm   163 VIHELFHVIGLWHEHMRADRDAFINVLYKNIEPAQYPQFEKLSSRDATTYSVPYDYNSVMHYDEN 227

  Fly   252 SFTRNGQPTLKALRATSDA---SQMGQRKGFSAGDVRKINAMYKC 293
            :|.:.|    |....|.|:   ..:|..|..|:.|.:|:.|:|.|
 Worm   228 AFAKPG----KISMMTKDSKFQKVIGHPKDASSNDYKKVCAIYHC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 74/204 (36%)
ZnMc_astacin_like 107..291 CDD:239807 70/190 (37%)
nas-5NP_492616.1 ZnMc_astacin_like 80..266 CDD:239807 70/190 (37%)
Astacin 83..269 CDD:279708 72/191 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.