DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and nas-29

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_494953.3 Gene:nas-29 / 186488 WormBaseID:WBGene00003547 Length:532 Species:Caenorhabditis elegans


Alignment Length:261 Identity:83/261 - (31%)
Similarity:120/261 - (45%) Gaps:39/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LNPEELGTYHEGDILIPLSYRDARFNGTRNGILALSSR--------------------------- 104
            ||.:......|||:.|.........||:.....|:.||                           
 Worm    81 LNKKYRDILFEGDMAISYKQLSMIVNGSTEYRKAIKSRRRGNKINGESTDRTKRQAYLDNNYPAT 145

  Fly   105 -WPGGV--VPYEIKGPFTSQELGNINHAFKEYHTKTCVRFKPRTTEKDYISIGSGKSGCWSSIGR 166
             |..||  :.:|...|.....:....|.   ::.:||:.|.|||.:|:|:.......||||::||
 Worm   146 IWKNGVAFMFHESLTPIAKTAILKAVHF---WYRETCIEFHPRTFQKEYLLFIGNDDGCWSTVGR 207

  Fly   167 --LGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSS 229
              ..|:|.|::  .|....:|...|||.||||.||||:|.:||..|......::.:::.||.|.|
 Worm   208 DASQGKQVVSI--GNGCEHFGVTSHELAHALGIFHEQSRFDRDESVVFNPRVVERDLLFNFAKIS 270

  Fly   230 SRTQYGFGVEYDYGSVMHYSPTSFTR-NGQPTLKALRATSDASQMGQRKGFSAGDVRKINAMYKC 293
            .|....:|:.||.||||||:||.|:. ...|||.|: .|:....|||.:|.|..||..:|..|:|
 Worm   271 PRQMSTYGLPYDIGSVMHYTPTEFSNIPSIPTLAAI-DTNLQQTMGQLEGPSFVDVHIMNQHYQC 334

  Fly   294 K 294
            :
 Worm   335 Q 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 73/224 (33%)
ZnMc_astacin_like 107..291 CDD:239807 69/188 (37%)
nas-29NP_494953.3 Astacin 145..336 CDD:279708 72/197 (37%)
ZnMc_astacin_like 148..332 CDD:239807 69/189 (37%)
CUB 404..491 CDD:214483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.