DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and nas-2

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_503678.3 Gene:nas-2 / 186345 WormBaseID:WBGene00003521 Length:272 Species:Caenorhabditis elegans


Alignment Length:238 Identity:80/238 - (33%)
Similarity:104/238 - (43%) Gaps:55/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 GDILIPLSYRDARFNGTRNGILAL------SSRWPGGVVPYEIKGPFTSQELGNINHAFKEYHTK 136
            |.|.|||.        .:.|| ||      |..||...|||:|...:||.|...|..|.:.:...
 Worm    36 GHINIPLR--------KKRGI-ALHPLQWASYLWPNAEVPYDIATHYTSTEKSIILSAMEAFKNV 91

  Fly   137 TCVRFKPR-TTEKDYISIGS--GKSGCWSSIGR-----LGGRQEVNLQS-----PNCLRTYGTPI 188
            |||||:|| .|:|.|:.|..  ....|:|.|||     |.|..|.|:::     |.|||..|..|
 Worm    92 TCVRFRPRAATDKHYLQINKYFNVERCFSYIGRQSSRTLFGTPEGNVETRMRLDPACLRGNGRGI 156

  Fly   189 --HELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPT 251
              |||||.|||:||..|.:||..:      :...:..|| |...|.:..:...||..|:|||:..
 Worm   157 VMHELMHILGFYHEHQRDDRDRRI------VGSAVHYNF-KIYRRAKTLYMGAYDANSIMHYNFQ 214

  Fly   252 SFTRNGQPTLKALRATSDASQMGQRKGFSAGDVRKINAMYKCK 294
            :.                  ...:|..||..|:..||..||||
 Worm   215 NL------------------PWQRRDHFSTSDIININTFYKCK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 70/206 (34%)
ZnMc_astacin_like 107..291 CDD:239807 64/198 (32%)
nas-2NP_503678.3 Astacin 58..240 CDD:279708 70/207 (34%)
ZnMc 62..236 CDD:294052 64/198 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.