DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and nas-13

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_510549.3 Gene:nas-13 / 185492 WormBaseID:WBGene00003532 Length:450 Species:Caenorhabditis elegans


Alignment Length:259 Identity:93/259 - (35%)
Similarity:139/259 - (53%) Gaps:29/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LGDTLFGNP-----DVETTGALVEALGVESPLNPEELGTYHEGDILIPLSYRDARFNGTRNGILA 100
            :.|:...||     |:..:|           ||...:.|:.....|..:      |...||.:..
 Worm    67 VNDSAMYNPLRFEGDIANSG-----------LNSRSINTFFGDSPLFGI------FGVQRNAVRQ 114

  Fly   101 LSSRWPGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCVRFKPRTT-EKDYISIGSGKSGCWSSI 164
            ...:|....:||.|...::|.....|..|.:||..|||:.|.|::. :.|||.| ....||:|.:
 Worm   115 TYLKWEQARIPYTISSQYSSYSRSKIAEAIEEYRKKTCIDFSPKSAGDLDYIHI-VPDDGCYSLV 178

  Fly   165 GRLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSS 229
            ||:||:|.|:| ...|::. |..|||||||:||||||:|.:||.||::...|::..:...|:|.|
 Worm   179 GRIGGKQPVSL-GDGCIQK-GIIIHELMHAVGFFHEQSRADRDEYVKINWSNVEAGLQDQFDKYS 241

  Fly   230 SRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTLKALRATSDASQMGQRKGFSAGDVRKINAMYKC 293
            .......|.:|||||||||:||:|::||:||::.:...   .::|||.|||..|:.|||.:|.|
 Worm   242 LNMIDHLGTKYDYGSVMHYAPTAFSKNGKPTIEPIEKN---VEIGQRAGFSENDIYKINMLYNC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 81/191 (42%)
ZnMc_astacin_like 107..291 CDD:239807 78/184 (42%)
nas-13NP_510549.3 Astacin 118..304 CDD:279708 81/191 (42%)
ZnMc_astacin_like 122..300 CDD:239807 78/183 (43%)
ShK 367..404 CDD:279838
ShK 414..450 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I2268
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I2674
Isobase 1 0.950 - 0 Normalized mean entropy S6346
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm4854
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.880

Return to query results.
Submit another query.