DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and nas-24

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_506409.2 Gene:nas-24 / 184744 WormBaseID:WBGene00003543 Length:396 Species:Caenorhabditis elegans


Alignment Length:239 Identity:63/239 - (26%)
Similarity:103/239 - (43%) Gaps:48/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LGTYHEGDILIPLSYRDARFNGTRNGILALSSRWPGGVVPY-------EIKGPFTSQELGNINHA 129
            |..::|.||....||:..:....|     |.|:|.||.:.|       .:|....|......|| 
 Worm    22 LSRFNEHDIEGGDSYKRVKREFER-----LGSKWLGGTINYYYADNNNSVKEKVKSAIAYIANH- 80

  Fly   130 FKEYHTKTCVRFKPRTTEKDYISIGSGK-SGCWSSIG----RLGGRQEVNLQSPNCLRTYGTPIH 189
                   ||::|....|....:.|.:.: |.|.|:||    |.|...|:::::..| ...|:.:|
 Worm    81 -------TCIKFNEDPTHWQRLKIFTSELSHCRSTIGAPGTRSGSAGELSMETGWC-ANIGSIVH 137

  Fly   190 ELMHALGFFHEQNRHERDSYVRVMKDNI----KPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSP 250
            |..|:||.:||..|.:||:.::|...:.    :|..|.        |.||   .:::||:|.|..
 Worm   138 EFSHSLGRYHEHTRPDRDNSLKVTSTDYEARPRPWGMT--------TMYG---PFEHGSIMMYHS 191

  Fly   251 TSF-TRNGQPTLKALRATSDASQMGQRKGFSAGDVRKINAMYKC 293
            ::: ....:|.....:.|     ||.|: .:..|:.|||..|.|
 Worm   192 SNYGVGKMEPYDMEYKNT-----MGSRR-VTFYDMYKINQYYGC 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 54/207 (26%)
ZnMc_astacin_like 107..291 CDD:239807 51/200 (26%)
nas-24NP_506409.2 Astacin 49..231 CDD:279708 54/207 (26%)
ZnMc 52..227 CDD:294052 51/200 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.