DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and nas-7

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_495552.2 Gene:nas-7 / 182368 WormBaseID:WBGene00003526 Length:382 Species:Caenorhabditis elegans


Alignment Length:291 Identity:100/291 - (34%)
Similarity:154/291 - (52%) Gaps:29/291 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLLIILGISLGDSMPLEDMDSQEMIDLTDLGDTLFGNPDVETTGALV--EALGVESPLNPEELG 73
            :.::.::..:||....::|   .||:.::|..|:| ...|.|....|.  |..|...|:   |:.
 Worm     7 ITIVTVIPATLGHRNRVQD---DEMLVISDSTDSL-NLEDFEFADKLTREELFGKHIPV---EVV 64

  Fly    74 TYHEGDILIPLSYRDARFNGTRNGILALSSRWPGGVVPYEIKGPFTSQELGNINHAFKEYHTKTC 138
            ...:.||.:|..::       |||:...:..||...:||.|...::..|...:..|.|:||.|||
 Worm    65 NDFKSDIRLPRRHK-------RNGVSRAAKLWPNARIPYAISPHYSPHERALLAKAVKQYHEKTC 122

  Fly   139 VRFKPRTT-EKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQN 202
            :||.||.| |.||:.||. ..||:|.:||..|.|.::|.: .|:. |.|.|||:||.:||:||..
 Worm   123 IRFVPRQTGEPDYLFIGK-VDGCFSEVGRTSGVQVLSLDN-GCME-YATIIHEMMHVVGFYHEHE 184

  Fly   203 RHERDSYVRVMKDNIKPEMMVNFEK-SSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTL--KAL 264
            |.:||:::.::..||....:..|.| ..|:|.| :|..|||.|::||...:|::||.||:  |..
 Worm   185 RWDRDNFIDIIWQNIDRGALDQFGKVDLSKTSY-YGQPYDYKSILHYDSLAFSKNGFPTMLPKVK 248

  Fly   265 RATSDASQMGQRKGFSAGDVRKINAMYKCKV 295
            .||     :|..:.||..|:.|||.||.|.|
 Worm   249 SAT-----IGNARDFSDVDISKINRMYNCPV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 78/194 (40%)
ZnMc_astacin_like 107..291 CDD:239807 73/187 (39%)
nas-7NP_495552.2 Astacin 87..274 CDD:279708 78/195 (40%)
ZnMc_astacin_like 91..270 CDD:239807 73/187 (39%)
ShK 347..382 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I2268
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm4854
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.