DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and nas-4

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001254938.1 Gene:nas-4 / 182259 WormBaseID:WBGene00003523 Length:365 Species:Caenorhabditis elegans


Alignment Length:279 Identity:106/279 - (37%)
Similarity:154/279 - (55%) Gaps:28/279 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 MDSQEMIDL------TDLGDTLFGNP-----DVETTGALVEALGVESPLNPEELGTYHEGDILI- 82
            ::::::||.      |.|.|..|.:.     |::|.|..|:    :.|    .:|.|.|||||: 
 Worm    24 VNNKQVIDTSVPQTETTLNDADFHSDLHQRYDLQTLGIKVK----DDP----TIGNYSEGDILLE 80

  Fly    83 -PLSYRDARFNGTRNGILALSSRWPGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCVRFKPRTT 146
             |..:.:......||.|..:..|||...:||.:...:.|.....|.:|..||||||||:|..|..
 Worm    81 SPKKFVEENNKLGRNAIKQIYRRWPNNEIPYTLSSQYGSYARSVIANAMNEYHTKTCVKFVARDP 145

  Fly   147 EK--DYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHERDSY 209
            .|  ||:.|...: ||:|.:|:.||:|.|:|.| .|::. ||.:||||||:||||||:|.:||||
 Worm   146 SKHHDYLWIHPDE-GCYSLVGKTGGKQPVSLDS-GCIQV-GTIVHELMHAVGFFHEQSRQDRDSY 207

  Fly   210 VRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTLKALRATSDASQMG 274
            :.|:..|:.......|||.:..........|||.|:|||.|.:|:.:|:.||...::.|:  :||
 Worm   208 IDVVWQNVMNGADDQFEKYNLNVISHLDEPYDYASIMHYGPYAFSGSGKKTLVPKKSGSE--RMG 270

  Fly   275 QRKGFSAGDVRKINAMYKC 293
            ||..||..||||||.:|.|
 Worm   271 QRVKFSDIDVRKINKLYNC 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 84/192 (44%)
ZnMc_astacin_like 107..291 CDD:239807 79/185 (43%)
nas-4NP_001254938.1 Astacin 102..290 CDD:279708 84/193 (44%)
ZnMc_astacin_like 106..287 CDD:239807 79/185 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I2268
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I2674
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm4854
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2664
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.