DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and nas-37

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001024413.1 Gene:nas-37 / 181208 WormBaseID:WBGene00003553 Length:765 Species:Caenorhabditis elegans


Alignment Length:275 Identity:88/275 - (32%)
Similarity:125/275 - (45%) Gaps:44/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EDMDSQEMIDLTD------LGDTLFGNPDVETTGALVEALGVESPLNPEELGTYHEGDILIPLSY 86
            |:||.....|.|:      |.:.:|.| |:..|....|:|..||.               .|.|.
 Worm    65 ENMDKSVKNDKTEATVNRKLWNEVFEN-DIILTLPQAESLLSESN---------------SPRSR 113

  Fly    87 RDARFNGTRNGILALSSRWPGGVVPYEI-KGPFTSQELGNINHAFKEYHTKTCVRFKPRTTEKDY 150
            |.|. ...||       .||...:.||. .|..|.::|  |..|.:......|.:||....::|.
 Worm   114 RQAH-PDPRN-------FWPNLTISYEFYGGEETWRQL--IRSAIRHVEQNVCFKFKENGGDRDG 168

  Fly   151 ISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKD 215
            :....| :||||::||:||||.|:: ...| .:.|...||.:||||.:|||:|.:||:::.::.|
 Worm   169 LRYYRG-NGCWSNVGRVGGRQLVSI-GYGC-DSLGIVSHETLHALGLWHEQSRDDRDNFISIVAD 230

  Fly   216 NIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRN-GQPTLKALRATSD---ASQMGQR 276
            .|......||.|.::......|..||.||||||...||..: ...|:|    |.|   .:.:|||
 Worm   231 KITRGTEGNFAKRTAANSDNLGQPYDLGSVMHYGAKSFAYDWSSDTIK----TRDWRYQNTIGQR 291

  Fly   277 KGFSAGDVRKINAMY 291
            .|.|..|.:.||..|
 Worm   292 DGLSFKDAKMINTRY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 68/193 (35%)
ZnMc_astacin_like 107..291 CDD:239807 65/188 (35%)
nas-37NP_001024413.1 Astacin 122..309 CDD:279708 69/201 (34%)
ZnMc_astacin_like 126..306 CDD:239807 65/188 (35%)
CUB 370..455 CDD:214483
TSP1 579..626 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.