Sequence 1: | NP_651242.1 | Gene: | CG5715 / 42895 | FlyBaseID: | FBgn0039180 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_508154.2 | Gene: | nas-15 / 180426 | WormBaseID: | WBGene00003534 | Length: | 571 | Species: | Caenorhabditis elegans |
Alignment Length: | 271 | Identity: | 97/271 - (35%) |
---|---|---|---|
Similarity: | 142/271 - (52%) | Gaps: | 45/271 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 ESPLNPE--ELGT-------YHEGDIL--IPLSYRDARFNGT--------------RNG------ 97
Fly 98 ----ILALSSR---WPGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCVRFKPR-TTEKDYISIG 154
Fly 155 SGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKP 219
Fly 220 EMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTLKALRATSDASQMGQRKGFSAGDV 284
Fly 285 RKINAMYKCKV 295 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5715 | NP_651242.1 | Astacin | 104..295 | CDD:279708 | 79/194 (41%) |
ZnMc_astacin_like | 107..291 | CDD:239807 | 74/184 (40%) | ||
nas-15 | NP_508154.2 | Astacin | 121..308 | CDD:279708 | 78/192 (41%) |
ZnMc_astacin_like | 126..304 | CDD:239807 | 74/183 (40%) | ||
ShKT | 354..388 | CDD:214586 | |||
ShK | 436..471 | CDD:279838 | |||
Gag_MA | <472..531 | CDD:279482 | |||
ShK | 535..571 | CDD:279838 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 170 | 1.000 | Domainoid score | I2268 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D472790at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000240 | |
OrthoInspector | 1 | 1.000 | - | - | mtm4854 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10127 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X245 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
10 | 9.920 |