DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and nas-15

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_508154.2 Gene:nas-15 / 180426 WormBaseID:WBGene00003534 Length:571 Species:Caenorhabditis elegans


Alignment Length:271 Identity:97/271 - (35%)
Similarity:142/271 - (52%) Gaps:45/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ESPLNPE--ELGT-------YHEGDIL--IPLSYRDARFNGT--------------RNG------ 97
            |:.|.||  ||||       :..||.:  ....|...||.|.              .||      
 Worm    44 ETVLTPEDFELGTRITAAMAHDNGDDIWDSDAMYSKDRFEGDIANDNLNASTAELFANGGSGKSE 108

  Fly    98 ----ILALSSR---WPGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCVRFKPR-TTEKDYISIG 154
                ..|:.:|   ||.|.:||.|...::|.....|..:.:||.:.||:|:.|: ..:.:|:.|.
 Worm   109 DGKWYNAIKNRLQLWPEGRIPYTISSQYSSYSRSLIAASMQEYASHTCIRWVPKEAADVNYVHIY 173

  Fly   155 SGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKP 219
            ..: ||:|.:|::||:|.::|.| .|::. |..:||||||:||||||:|.:||.::.:|.:||:.
 Worm   174 PDR-GCYSMVGKMGGKQSLSLGS-GCIQK-GIILHELMHAVGFFHEQSRTDRDDHITIMWNNIQA 235

  Fly   220 EMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTLKALRATSDASQMGQRKGFSAGDV 284
            .|...|||....|....|..|||||:|||...:|:||||||:...:   :.:.:|||.|||..|.
 Worm   236 GMQGQFEKYGHGTIQSLGTGYDYGSIMHYGTKAFSRNGQPTMIPKK---NGATIGQRNGFSKVDK 297

  Fly   285 RKINAMYKCKV 295
            .|||.:|.|.|
 Worm   298 FKINTLYGCPV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 79/194 (41%)
ZnMc_astacin_like 107..291 CDD:239807 74/184 (40%)
nas-15NP_508154.2 Astacin 121..308 CDD:279708 78/192 (41%)
ZnMc_astacin_like 126..304 CDD:239807 74/183 (40%)
ShKT 354..388 CDD:214586
ShK 436..471 CDD:279838
Gag_MA <472..531 CDD:279482
ShK 535..571 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I2268
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm4854
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.920

Return to query results.
Submit another query.