Sequence 1: | NP_651242.1 | Gene: | CG5715 / 42895 | FlyBaseID: | FBgn0039180 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_503351.3 | Gene: | nas-32 / 178595 | WormBaseID: | WBGene00003550 | Length: | 653 | Species: | Caenorhabditis elegans |
Alignment Length: | 264 | Identity: | 75/264 - (28%) |
---|---|---|---|
Similarity: | 105/264 - (39%) | Gaps: | 62/264 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 NPEELGTYH------------EGDILIPLSYRDARFNGTRNGILALSSR---------------- 104
Fly 105 --WPGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCVRFKPRTTEKDYISIGSGKSGCWSSIGRL 167
Fly 168 GGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRT 232
Fly 233 QYGFGVEYDYGSVMHYSPTSFTRNG--------QPTLKALRATSDASQMGQRKGFSAGDVRKINA 289
Fly 290 MYKC 293 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5715 | NP_651242.1 | Astacin | 104..295 | CDD:279708 | 64/216 (30%) |
ZnMc_astacin_like | 107..291 | CDD:239807 | 60/191 (31%) | ||
nas-32 | NP_503351.3 | Astacin | 210..397 | CDD:279708 | 64/199 (32%) |
ZnMc_astacin_like | 214..393 | CDD:239807 | 60/191 (31%) | ||
CUB | 464..>528 | CDD:294042 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D681837at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10127 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.920 |