DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and nas-36

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_492109.2 Gene:nas-36 / 172506 WormBaseID:WBGene00003552 Length:617 Species:Caenorhabditis elegans


Alignment Length:264 Identity:79/264 - (29%)
Similarity:121/264 - (45%) Gaps:24/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FGNPDVETTGALVEALGVESPLNPEELGTYHEGDILIPLSYRDA-------------RFNGTRNG 97
            ||:..||.:...|.....:..:|.:......||||.  ||.|.|             |..  |:.
 Worm    68 FGHDAVEDSKKEVAISTQQGTINKKVSPFLFEGDIF--LSRRQAVDILKALSKDKTKRLR--RSF 128

  Fly    98 ILALSSRWPGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCVRFK--PRTTEKDYISIGSGKSGC 160
            :...::.|....:.|..........:..|..|.:.:...||:.|:  ..:.:.|||...||: ||
 Worm   129 VSDKTATWKTMPIKYRFHESIDFYTISQIIAAIRFWEDSTCITFENVSDSPDGDYIEFFSGQ-GC 192

  Fly   161 WSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNF 225
            :|.|||.||||.::: ..:|:: .|...||:.||||.:|||:|.:...||.:.:|.|.|..:.:|
 Worm   193 YSMIGRNGGRQGISI-GESCVK-MGVIEHEIGHALGLWHEQSRPDALGYVTIERDFILPSYISDF 255

  Fly   226 EKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTLKALRATSDASQMGQRKGFSAGDVRKINAM 290
            .:...... ..|:.||.||||||..|:|:.:.:......|.:.....:|||:..|..||..||..
 Worm   256 LQRDDEID-TLGIPYDLGSVMHYGSTAFSVDQKSKTVVTRDSLYQQTIGQREKLSFYDVATINTA 319

  Fly   291 YKCK 294
            | ||
 Worm   320 Y-CK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 63/193 (33%)
ZnMc_astacin_like 107..291 CDD:239807 59/185 (32%)
nas-36NP_492109.2 Astacin 134..323 CDD:279708 63/194 (32%)
ZnMc_astacin_like 140..320 CDD:239807 59/183 (32%)
CUB 380..478 CDD:214483
TSP1 510..556 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.