DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and astl

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_031755136.1 Gene:astl / 101730245 XenbaseID:XB-GENE-5769376 Length:972 Species:Xenopus tropicalis


Alignment Length:244 Identity:84/244 - (34%)
Similarity:132/244 - (54%) Gaps:29/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LGVESPLNPEELGTYHEGDILIPLSYRDARFNGTRNGILALSSR---WP---GGV-VPYEIKGPF 118
            |.:..||.........||||:           ..:..|...|:|   ||   |.| :||.:...:
 Frog    40 LDINGPLIQGGASGLMEGDIV-----------KEKRSIRTFSARFAKWPKINGSVIIPYTLSSSY 93

  Fly   119 TSQELGNINHAFKEYHTKTCVRFKPRTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRT 183
            .|.:...|..||::....||:||..||||:|||:| ....||:||:||:||.|.|:| :..||||
 Frog    94 ESFDRNIILKAFRDLQASTCLRFVERTTERDYIAI-EPAIGCFSSVGRVGGMQLVSL-AFECLRT 156

  Fly   184 ---YGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSR-TQYGFGVEYDYGS 244
               .|..:|||||..||:||.:|.:||.|:.::.|    |:::.:||:..: ......|:|:..|
 Frog   157 DKGKGIALHELMHVAGFWHEHSRADRDDYIWIIWD----EILIGYEKNFCKYATTNMLVKYELQS 217

  Fly   245 VMHYSPTSFTRNGQPTLKALRATSDASQMGQRKGFSAGDVRKINAMYKC 293
            ::||..::|:::||.|:......|.. ::|||:..||.|:.::|.:|.|
 Frog   218 ILHYPRSAFSKSGQATINPKYPYSKI-EIGQREKLSASDILRVNKLYSC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 75/201 (37%)
ZnMc_astacin_like 107..291 CDD:239807 70/188 (37%)
astlXP_031755136.1 ZnMc_astacin_like 84..263 CDD:239807 68/185 (37%)
MAM 817..971 CDD:99706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 1 1.100 - - O PTHR10127
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.160

Return to query results.
Submit another query.