DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and astl3a.3

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_031746774.1 Gene:astl3a.3 / 100498584 XenbaseID:XB-GENE-22069675 Length:529 Species:Xenopus tropicalis


Alignment Length:312 Identity:101/312 - (32%)
Similarity:152/312 - (48%) Gaps:46/312 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LIILGISLGDS--------MPLEDMDSQEMIDLTDLGDTLFGNPDVETTGALVEALGVESPLNPE 70
            :|:|...:|.:        .|.::|..::.:...||.:.|..:.:.:.........|:|.|:..:
 Frog     9 IILLACIMGSAWTYPAQIIFPYQEMLEKDSLTNLDLLEALGKSAEKDALATEGTVRGMEMPVLGK 73

  Fly    71 ELGTY-----------------HEGDILIPLSYRDARFNGTRNGILALSSRWPGG-----VVPYE 113
            :.|:.                 ::||||.|..         |:.:......||..     :|||.
 Frog    74 KSGSVDVFTQISKVNRGIRVPTYQGDILRPKG---------RSAMNCTECLWPKSTDGTVIVPYN 129

  Fly   114 IKGPFTSQELGNINHAFKEYHTKTCVRFKPRTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSP 178
            ....:::.:|.......:||.:.|||||.||..|.|::||.| .:||.|.:|::||.|.|.|.|.
 Frog   130 FSSNYSADQLALFKSTMQEYESLTCVRFVPRANETDFLSIVS-DNGCASFLGKVGGDQTVQLDSY 193

  Fly   179 NCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYG 243
            .|:.. |...|||.|||||:|||:|.:||.||.:..:||.|....||.|:.|.   ..|:||||.
 Frog   194 GCIYR-GIIQHELNHALGFYHEQSRSDRDDYVTIHTENIIPGYEGNFNKADSN---NLGLEYDYS 254

  Fly   244 SVMHYSPTSFTRNGQPTLKALRATSDASQMGQRKGFSAGDVRKINAMYKCKV 295
            ||||||..:|::||..|:  :........:|||.|.|..||.|||.:|:|.|
 Frog   255 SVMHYSGDAFSKNGNLTI--VPKPDPTVPIGQRDGLSILDVSKINRLYQCDV 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 82/195 (42%)
ZnMc_astacin_like 107..291 CDD:239807 78/188 (41%)
astl3a.3XP_031746774.1 ZnMc_hatching_enzyme 121..302 CDD:239810 79/187 (42%)
CUB 306..414 CDD:238001
CUB 419..527 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.