DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5715 and LOC100496745

DIOPT Version :9

Sequence 1:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_017948777.1 Gene:LOC100496745 / 100496745 -ID:- Length:432 Species:Xenopus tropicalis


Alignment Length:227 Identity:87/227 - (38%)
Similarity:122/227 - (53%) Gaps:24/227 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EGDILIPLSYRDARFNGTRNGIL--ALSSRWPGG-----VVPYEIKGPFTSQELGNINHAFKEYH 134
            :|||.:..|         ||.::  ..|..||..     :|||.:...:.|.|...|..|..|..
 Frog     3 QGDIAVKKS---------RNALMCPGKSCLWPRSRKGLVLVPYTLSNNYNSTERDIIRAAMDEVT 58

  Fly   135 TKTCVRFKPRTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFH 199
            ..||::|.....|.||:.| ....||||.|||:||.|:|:|....||. :|...|||:|:|||.|
 Frog    59 VLTCIQFVTYNNESDYLRI-RPYDGCWSYIGRVGGAQDVSLMKTGCLH-HGVIQHELLHSLGFQH 121

  Fly   200 EQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSF-TRNGQPTLKA 263
            ||.|.:||:|:.:..|||..:...||.|.:::   ..|..|||.|||||...:| |.:|:|||:.
 Frog   122 EQCRSDRDNYININWDNISHDKERNFLKMNTQ---NLGSPYDYLSVMHYGKFAFATNSGKPTLEP 183

  Fly   264 LRATSDASQMGQRKGFSAGDVRKINAMYKCKV 295
              ..:.::.:|||.|.|:.||.|||.:|:|.|
 Frog   184 --KGNPSAMIGQRVGLSSLDVEKINRLYQCSV 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5715NP_651242.1 Astacin 104..295 CDD:279708 79/196 (40%)
ZnMc_astacin_like 107..291 CDD:239807 75/189 (40%)
LOC100496745XP_017948777.1 ZnMc 30..211 CDD:412141 76/187 (41%)
CUB 232..321 CDD:238001
CUB 324..428 CDD:395345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.